H2AFZ Peptide - N-terminal region
H2AFZ Peptide - N-terminal region
Product Specifications
Product Name Alternative
H2AZ, H2A.z, H2A/z, H2A.Z-1
UniProt
P0C0S5
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with H2AFZ Rabbit Polyclonal Antibody (orb327297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_002097
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP720354M 50 µg
Prostatic Acid Phosphatase (ACPP) (NM_001099) Human Recombinant Protein
Sign In for Pricing
View Details 
LC419865 20 µg
IKK beta (IKBKB) (NM_001556) Human Over-expression Lysate
Sign In for Pricing
View Details 