IMP3 Peptide - N-terminal region
IMP3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IMP3, C15orf12, MRPS4
UniProt
Q9NV31
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IMP3 Rabbit Polyclonal Antibody (orb588283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060755
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1728-100 1x 100 µL
Parathyroid Hormone (PTH) (N-Terminal), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Frataxin (FXN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C3]](https://cdn.genprice.uk/products/937/6868c34f994c49e6dc3f4452/imageurl/ta504352am.webp)
TA504352AM 100 µL
Frataxin (FXN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C3]
Sign In for Pricing
View Details 
TRC-B431500-5G 5 g
(R,R)-(-)-N,N’-Bis(3,5-di-tert-butylsalicylidene)-1,2-cyclohexanediamine
Sign In for Pricing
View Details