IMP3 Peptide - N-terminal region
IMP3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IMP3, C15orf12, MRPS4
UniProt
Q9NV31
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IMP3 Rabbit Polyclonal Antibody (orb588283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060755
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-TIMP2-c-01 96 Tests
Canine Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA Kit
Sign In for Pricing
View Details RDR-TIMP2-c-02 48 Tests
Canine Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA Kit
Sign In for Pricing
View Details 
