Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ME1 Peptide - C-terminal region

ME1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MES, HUMNDME

UniProt

P48163

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ME1 Rabbit Polyclonal Antibody (orb327306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002386

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL1B (NM_004918) Human Recombinant Protein
TP308593L 1 mg

TCL1B (NM_004918) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mucin 5AC Antibody
RC-16885-01 50 μL

Recombinant Mucin 5AC Antibody

Sign In for Pricing
View Details
Recombinant Mucin 5AC Antibody
RC-16885-02 100 µL

Recombinant Mucin 5AC Antibody

Sign In for Pricing
View Details
Recombinant Mucin 5AC Antibody
RC-16885-03 1 mL

Recombinant Mucin 5AC Antibody

Sign In for Pricing
View Details
IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: OTI4A12]
CF814599 100 µg

IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: OTI4A12]

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), CF647 conjugate, 0.1mg/mL
BNC472121-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details