Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCLN Peptide - N-terminal region

NCLN Peptide - N-terminal region

Product Specifications

Product Name Alternative

NCLN

UniProt

Q969V3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCLN Rabbit Polyclonal Antibody (orb588307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-II-,  5nm
GP-2002-5 1 mL

Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-II-, 5nm

Sign In for Pricing
View Details
Stx2 Mouse Gene Knockout Kit (CRISPR)
KN516929 1 Kit

Stx2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZNF239 activation kit by CRISPRa
GA105431 1 Kit

Human ZNF239 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS707133 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD226/DNAM-1 Antibody[11A8]
E-AB-F1369M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD226/DNAM-1 Antibody[11A8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD226/DNAM-1 Antibody[11A8]
E-AB-F1369M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD226/DNAM-1 Antibody[11A8]

Sign In for Pricing
View Details