Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB8 Peptide - N-terminal region

NDUFB8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASHI, CI-ASHI

UniProt

O95169

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB8 Rabbit Polyclonal Antibody (orb327308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004995

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL21C (NM_001010977) Human Recombinant Protein
TP317219M 100 µg

METTL21C (NM_001010977) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF250 Human Gene Knockout Kit (CRISPR)
KN402281 1 Kit

ZNF250 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNMT3A (C-term) Rabbit Polyclonal Antibody
AP51303PU-N 400 µL

DNMT3A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,3-Dihydroxy-1,4-naphthoquinone
TRC-D360510-50MG 50 mg

2,3-Dihydroxy-1,4-naphthoquinone

Sign In for Pricing
View Details
AMF Antibody
KC-121-01 50 μL

AMF Antibody

Sign In for Pricing
View Details
AMF Antibody
KC-121-02 100 µL

AMF Antibody

Sign In for Pricing
View Details