Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB8 Peptide - N-terminal region

NDUFB8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASHI, CI-ASHI

UniProt

O95169

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB8 Rabbit Polyclonal Antibody (orb327308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004995

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd300lf Mouse Gene Knockout Kit (CRISPR)
KN502903 1 Kit

Cd300lf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ezrin (EZR) Rabbit Polyclonal Antibody
TA376055 100 µL

Ezrin (EZR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NELL1 Antibody
KC-8369-01 50 μL

NELL1 Antibody

Sign In for Pricing
View Details
NELL1 Antibody
KC-8369-02 100 µL

NELL1 Antibody

Sign In for Pricing
View Details
NELL1 Antibody
KC-8369-03 1 mL

NELL1 Antibody

Sign In for Pricing
View Details
(+)-13alpha-Hydroxylupanine
TRC-H943795-1MG 1 mg

(+)-13alpha-Hydroxylupanine

Sign In for Pricing
View Details