Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1D2 Peptide - N-terminal region

NR1D2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1D2

UniProt

Q14995

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1D2 Rabbit Polyclonal Antibody (orb588312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005117

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bax Double Nickase Plasmid (m)
sc-419292-NIC 20 µg

Bax Double Nickase Plasmid (m)

Sign In for Pricing
View Details
ZNF295 discontinued
543944-01 30ul

ZNF295 discontinued

Sign In for Pricing
View Details
ZNF295 discontinued
543944-02 100 µL

ZNF295 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal CPT2 Antibody
NBP1-32226 100 µL

Rabbit Polyclonal CPT2 Antibody

Sign In for Pricing
View Details
Apo-SAA
100-127-L100 100 µg

Apo-SAA

Sign In for Pricing
View Details
Cacna1s sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7512807 1.0 µg DNA

Cacna1s sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details