Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1D2 Peptide - N-terminal region

NR1D2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1D2

UniProt

Q14995

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1D2 Rabbit Polyclonal Antibody (orb588312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005117

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc5a3 (NM_053715) Rat Tagged Lenti ORF Clone
RR214450L3 10 µg

Slc5a3 (NM_053715) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Platelet Factor 4, Human (PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, PF4, CXCL4, SCYB4)
MBS634794-01 0.1 mg

Platelet Factor 4, Human (PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, PF4, CXCL4, SCYB4)

Sign In for Pricing
View Details
Platelet Factor 4, Human (PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, PF4, CXCL4, SCYB4)
MBS634794-02 5x 0.1 mg

Platelet Factor 4, Human (PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, PF4, CXCL4, SCYB4)

Sign In for Pricing
View Details
Rabbit Phospholipase D2 (PLD2) ELISA Kit
abx362485 96 Well

Rabbit Phospholipase D2 (PLD2) ELISA Kit

Sign In for Pricing
View Details
CD195/CCR5 Human Monoclonal Antibody (APC)
orb2972745-01 50 Tests

CD195/CCR5 Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
CD195/CCR5 Human Monoclonal Antibody (APC)
orb2972745-02 100 Tests

CD195/CCR5 Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details