Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRAS Peptide - C-terminal region

HRAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTLO, KRAS, HAMSV, HRAS1, KRAS2, RASH1, RASK2, Ki-Ras, p21ras, C-H-RAS, c-K-ras, H-RASIDX, c-Ki-ras, C-BAS/HAS, C-HA-RAS1

UniProt

P01112

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HRAS Rabbit Polyclonal Antibody (orb588409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Paraoxonase 1 (PON1) ELISA Kit
orb1664015-01 48 Tests

Mouse Paraoxonase 1 (PON1) ELISA Kit

Sign In for Pricing
View Details
Mouse Paraoxonase 1 (PON1) ELISA Kit
orb1664015-02 96 Tests

Mouse Paraoxonase 1 (PON1) ELISA Kit

Sign In for Pricing
View Details
HMPV M/Matrix protein ELISA Kit
VK777018 96 Tests

HMPV M/Matrix protein ELISA Kit

Sign In for Pricing
View Details
Rat Platelet Glycoprotein Ib-IX-V Complex (GPIb-IX-V) ELISA Kit
abx354091 96 Well

Rat Platelet Glycoprotein Ib-IX-V Complex (GPIb-IX-V) ELISA Kit

Sign In for Pricing
View Details
RPS6KA3-set siRNA/shRNA/RNAi Lentivector (Human)
42594091 4x 500 ng

RPS6KA3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
GRIP-1 Lentiviral Activation Particles (h2)
sc-401800-LAC-2 200 µL

GRIP-1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details