HRAS Peptide - C-terminal region
HRAS Peptide - C-terminal region
Product Specifications
Product Name Alternative
CTLO, KRAS, HAMSV, HRAS1, KRAS2, RASH1, RASK2, Ki-Ras, p21ras, C-H-RAS, c-K-ras, H-RASIDX, c-Ki-ras, C-BAS/HAS, C-HA-RAS1
UniProt
P01112
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HRAS Rabbit Polyclonal Antibody (orb588409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog