Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRAS Peptide - C-terminal region

HRAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTLO, KRAS, HAMSV, HRAS1, KRAS2, RASH1, RASK2, Ki-Ras, p21ras, C-H-RAS, c-K-ras, H-RASIDX, c-Ki-ras, C-BAS/HAS, C-HA-RAS1

UniProt

P01112

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HRAS Rabbit Polyclonal Antibody (orb588409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat AP 3 complex subunit mu 2 (AP3M2) ELISA kit
GTR10395778 96 Well

Goat AP 3 complex subunit mu 2 (AP3M2) ELISA kit

Sign In for Pricing
View Details
Rat Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7) ELISA Kit
DLR-MYH7-Ra-01 48 Tests

Rat Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7) ELISA Kit

Sign In for Pricing
View Details
Rat Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7) ELISA Kit
DLR-MYH7-Ra-02 96 Tests

Rat Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7) ELISA Kit

Sign In for Pricing
View Details
NOX3 ORF Vector (Human) (pORF)
ORF026189 1.0 µg DNA

NOX3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
P53 Antibody
orb1336305 100 µg

P53 Antibody

Sign In for Pricing
View Details
IL1A/IL1F1 Polyclonal Antibody
E55A00350 100 µg

IL1A/IL1F1 Polyclonal Antibody

Sign In for Pricing
View Details