Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF11 Peptide - N-terminal region

KIF11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIF11, EG5, KNSL1, TRIP5

UniProt

P52732

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF11 Rabbit Polyclonal Antibody (orb588413) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004514

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (Tumor Marker) (CTSD/3275), CF594 conjugate, 0.1mg/mL
BNC943275-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3275), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tomm70a Mouse Gene Knockout Kit (CRISPR)
KN518054 1 Kit

Tomm70a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PPIL5 (LRR1) (NM_203467) Human Over-expression Lysate
LC404280 20 µg

PPIL5 (LRR1) (NM_203467) Human Over-expression Lysate

Sign In for Pricing
View Details
GDF3 Recombinant Rabbit Monoclonal Antibody [JE38-51]
HA722339 100 µL

GDF3 Recombinant Rabbit Monoclonal Antibody [JE38-51]

Sign In for Pricing
View Details
Two Component PCR Plates
P9096-HSW 50 Units/Pack

Two Component PCR Plates

Sign In for Pricing
View Details
CD3e Mouse Monoclonal Antibody (SK7), R-PE Conjugate - Biotium Choice
P002-RPE-125 1x 125 µL

CD3e Mouse Monoclonal Antibody (SK7), R-PE Conjugate - Biotium Choice

Sign In for Pricing
View Details