Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO5 Peptide - N-terminal region

IPO5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IPO5, KPNB3, RANBP5

UniProt

O00410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPO5 Rabbit Polyclonal Antibody (orb588415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF3 Mouse Monoclonal Antibody [Clone ID: 3F10]
AM05643PU-N 100 µg

IRF3 Mouse Monoclonal Antibody [Clone ID: 3F10]

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal), CF740 conjugate, 0.1mg/mL
BNC741728-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYK2 Human Gene Knockout Kit (CRISPR)
KN204351 1 Kit

TYK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NCRNA00174 (LINC00174) (NM_181722) Human Recombinant Protein
TP312799M 100 µg

NCRNA00174 (LINC00174) (NM_181722) Human Recombinant Protein

Sign In for Pricing
View Details
ENPP2 Antibody
KC-29058-01 50 μL

ENPP2 Antibody

Sign In for Pricing
View Details
ENPP2 Antibody
KC-29058-02 100 µL

ENPP2 Antibody

Sign In for Pricing
View Details