Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO5 Peptide - N-terminal region

IPO5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IPO5, KPNB3, RANBP5

UniProt

O00410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPO5 Rabbit Polyclonal Antibody (orb588415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nrarp (NM_025980) Mouse Tagged ORF Clone
MG200468 10 µg

Nrarp (NM_025980) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Loreclezole Hydrochloride
TRC-L470008-50MG 50 mg

Loreclezole Hydrochloride

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody
AP02382PU-S 50 µL

VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bicd1 Mouse Gene Knockout Kit (CRISPR)
KN502164 1 Kit

Bicd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF640R conjugate, 0.1mg/mL
BNC402244-500 1x 500 µL

Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Oxo-1-phenyl-3-(2’-hydroxy-5-benzyloxyphenyl)propene
TRC-O870100-10MG 10 mg

3-Oxo-1-phenyl-3-(2’-hydroxy-5-benzyloxyphenyl)propene

Sign In for Pricing
View Details