Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMNA Peptide - C-terminal region

LMNA Peptide - C-terminal region

Product Specifications

Product Name Alternative

LMNA, LMN1

UniProt

P02545

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMNA Rabbit Polyclonal Antibody (orb588416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentylmagnesium bromide 2M in Diethyl ether
90026953 100 mL

Pentylmagnesium bromide 2M in Diethyl ether

Sign In for Pricing
View Details
Neisser's Stain B Soln. (Crystal Violet)
V0195 00125 125 mL

Neisser's Stain B Soln. (Crystal Violet)

Sign In for Pricing
View Details
CAB39L Polyclonal Antibody, PE Conjugated
bs-6802R-PE 100 µL

CAB39L Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Goat Chymotrypsin-Like Elastase Family Member 2A (CELA2A) ELISA Kit
MBS9903163 Inquire

Goat Chymotrypsin-Like Elastase Family Member 2A (CELA2A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human ZNF502 Protein
E30P2543 20 µg

Recombinant Human ZNF502 Protein

Sign In for Pricing
View Details
EIF4E Antibody - middle region
ARP87212_P050-25UL 25 µL

EIF4E Antibody - middle region

Sign In for Pricing
View Details