Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMNA Peptide - C-terminal region

LMNA Peptide - C-terminal region

Product Specifications

Product Name Alternative

LMNA, LMN1

UniProt

P02545

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMNA Rabbit Polyclonal Antibody (orb588416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRDM16 shRNA (UAS) - Lentiviral human PRDM16 shRNA (UAS) (25)
GTR15101897 1 Vial

Lentiviral human PRDM16 shRNA (UAS) - Lentiviral human PRDM16 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Anti-OR2H1 Polyclonal Antibody
PAV2768 100 μL

Rabbit Anti-OR2H1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2
MBS1045395-01 0.02 mg (E-Coli)

Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2

Sign In for Pricing
View Details
Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2
MBS1045395-02 0.02 mg (Yeast)

Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2

Sign In for Pricing
View Details
Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2
MBS1045395-03 0.1 mg (E-Coli)

Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2

Sign In for Pricing
View Details
Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2
MBS1045395-04 0.1 mg (Yeast)

Recombinant Loxosceles apachea Sphingomyelin phosphodiesterase D LapSicTox-alphaIB1b2

Sign In for Pricing
View Details