Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51D Peptide - C-terminal region

RAD51D Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAD, R51H3, BROVCA4, RAD51L3

UniProt

O75771

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD51D Rabbit Polyclonal Antibody (orb327318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_598332

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMVDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI4 Antibody (YA6877, Rabbit)
HY-P87189-01 10 µL

PADI4 Antibody (YA6877, Rabbit)

Sign In for Pricing
View Details
PADI4 Antibody (YA6877, Rabbit)
HY-P87189-02 50 μL

PADI4 Antibody (YA6877, Rabbit)

Sign In for Pricing
View Details
PADI4 Antibody (YA6877, Rabbit)
HY-P87189-03 100 µL

PADI4 Antibody (YA6877, Rabbit)

Sign In for Pricing
View Details
KPNB1 Polyclonal Antibody
MBS8574062-01 0.1 mL

KPNB1 Polyclonal Antibody

Sign In for Pricing
View Details
KPNB1 Polyclonal Antibody
MBS8574062-02 0.1 mL (AF405L)

KPNB1 Polyclonal Antibody

Sign In for Pricing
View Details
KPNB1 Polyclonal Antibody
MBS8574062-03 0.1 mL (AF405S)

KPNB1 Polyclonal Antibody

Sign In for Pricing
View Details