SNRPD3 Peptide - middle region
SNRPD3 Peptide - middle region
Product Specifications
Product Name Alternative
SMD3, Sm-D3
UniProt
P62318
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRPD3 Rabbit Polyclonal Antibody (orb327324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004166
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAAR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-0243R-BF594 100 µL
EXPB-2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details 
![N-[3,5-Bis (trifluoroMethyl) phenyl]-N'-[ (9R) -6'-Methoxy-9-cinchonanyl]thiourea](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FB100790-01 10 mg
N-[3,5-Bis (trifluoroMethyl) phenyl]-N'-[ (9R) -6'-Methoxy-9-cinchonanyl]thiourea
Sign In for Pricing
View Details FB100790-02 25 mg
N-[3,5-Bis (trifluoroMethyl) phenyl]-N'-[ (9R) -6'-Methoxy-9-cinchonanyl]thiourea
Sign In for Pricing
View Details