Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14 Peptide - C-terminal region

USP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TGT

UniProt

P54578

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP14 Rabbit Polyclonal Antibody (orb327336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005142

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human B7-H4/VTCN1 Protein
RP00218-01 10 μg

Recombinant Human B7-H4/VTCN1 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein
RP00218-02 20 μg

Recombinant Human B7-H4/VTCN1 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein
RP00218-03 50 μg

Recombinant Human B7-H4/VTCN1 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein
RP00218-04 100 μg

Recombinant Human B7-H4/VTCN1 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein
RP00218-05 500 μg

Recombinant Human B7-H4/VTCN1 Protein

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein
RP00218-06 1000 μg

Recombinant Human B7-H4/VTCN1 Protein

Sign In for Pricing
View Details