Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14 Peptide - C-terminal region

USP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TGT

UniProt

P54578

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP14 Rabbit Polyclonal Antibody (orb327336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005142

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRR3 AAV Vector (Mouse) (CMV)
45396104 1 µg

SPRR3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
ANKRD11 Antibody, HRP conjugated
A58929-50UG 50 µg

ANKRD11 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human Chromogranin-A(CHGA)
AP70162-01 20 µg

Recombinant Human Chromogranin-A(CHGA)

Sign In for Pricing
View Details
Recombinant Human Chromogranin-A(CHGA)
AP70162-02 100 µg

Recombinant Human Chromogranin-A(CHGA)

Sign In for Pricing
View Details
Recombinant Human Chromogranin-A(CHGA)
AP70162-03 1 mg

Recombinant Human Chromogranin-A(CHGA)

Sign In for Pricing
View Details
ACTGP3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0036202 1.0 µg DNA

ACTGP3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details