Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB33A Peptide - C-terminal region

RAB33A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RabS10

UniProt

Q14088

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB33A Rabbit Polyclonal Antibody (orb327337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004785

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Gata Binding Protein 5 ELISA Kit
MBS078516 Inquire

Duck Gata Binding Protein 5 ELISA Kit

Sign In for Pricing
View Details
Recombinant Phospholipase A1 (PLA1)
TRV-0008694-01 10 µg

Recombinant Phospholipase A1 (PLA1)

Sign In for Pricing
View Details
Recombinant Phospholipase A1 (PLA1)
TRV-0008694-02 50 µg

Recombinant Phospholipase A1 (PLA1)

Sign In for Pricing
View Details
Recombinant Phospholipase A1 (PLA1)
TRV-0008694-03 100 µg

Recombinant Phospholipase A1 (PLA1)

Sign In for Pricing
View Details
Recombinant Phospholipase A1 (PLA1)
TRV-0008694-04 200 µg

Recombinant Phospholipase A1 (PLA1)

Sign In for Pricing
View Details
Recombinant Phospholipase A1 (PLA1)
TRV-0008694-05 500 µg

Recombinant Phospholipase A1 (PLA1)

Sign In for Pricing
View Details