Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED17 Peptide - middle region

MED17 Peptide - middle region

Product Specifications

Product Name Alternative

MED17, ARC77, CRSP6, DRIP77, DRIP80, TRAP80

UniProt

Q9NVC6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED17 Rabbit Polyclonal Antibody (orb588458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004259

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZFAND1 Antibody [Janelia Fluor 549]
NBP3-05974JF549 0.1 mL

Rabbit Polyclonal ZFAND1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Human TSLPR&IL-7RA Protein
orb2993098-01 10 µg

Recombinant Human TSLPR&IL-7RA Protein

Sign In for Pricing
View Details
Recombinant Human TSLPR&IL-7RA Protein
orb2993098-02 50 µg

Recombinant Human TSLPR&IL-7RA Protein

Sign In for Pricing
View Details
Recombinant Human TSLPR&IL-7RA Protein
orb2993098-03 500 µg

Recombinant Human TSLPR&IL-7RA Protein

Sign In for Pricing
View Details
Recombinant Human TSLPR&IL-7RA Protein
orb2993098-04 1 mg

Recombinant Human TSLPR&IL-7RA Protein

Sign In for Pricing
View Details
Rat UGT2B7 shRNA Plasmid
abx988195-01 150 µg

Rat UGT2B7 shRNA Plasmid

Sign In for Pricing
View Details