Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED17 Peptide - middle region

MED17 Peptide - middle region

Product Specifications

Product Name Alternative

MED17, ARC77, CRSP6, DRIP77, DRIP80, TRAP80

UniProt

Q9NVC6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED17 Rabbit Polyclonal Antibody (orb588458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004259

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (4-Bromophenyl) thiazol-2-amine
OR1047353-01 100 mg

5- (4-Bromophenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (4-Bromophenyl) thiazol-2-amine
OR1047353-02 250 mg

5- (4-Bromophenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (4-Bromophenyl) thiazol-2-amine
OR1047353-03 1 g

5- (4-Bromophenyl) thiazol-2-amine

Sign In for Pricing
View Details
DMRTC2 (NM_001040283) Human Tagged ORF Clone Lentiviral Particle
RC206725L4V 200 µL

DMRTC2 (NM_001040283) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Gsta2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3828702 1.0 µg DNA

Gsta2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Polyclonal Antibody to DNA Methyltransferase 1 (DNMT1)
TRV-0058048-01 20 µL

Polyclonal Antibody to DNA Methyltransferase 1 (DNMT1)

Sign In for Pricing
View Details