Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF7 Peptide - N-terminal region

RNF7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SAG, ROC2, rbx2, CKBBP1

UniProt

Q9UBF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF7 Rabbit Polyclonal Antibody (orb327338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) ileS Polyclonal Antibody
MBS7166504 Inquire

Rabbit anti-Escherichia coli (strain K12) ileS Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Herpes Simplex Virus 1 Antibody [Janelia Fluor 549]
NB600-516JF549 0.1 mL

Rabbit Polyclonal Herpes Simplex Virus 1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Anti-MASP1 Rabbit Polyclonal Antibody
orb2569073 100 µg

Anti-MASP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PP2A-Cα/β (C-1) : m-IgG1 BP-HRP Bundle
sc-545480 1 Kit

PP2A-Cα/β (C-1) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
HSFY2 (Heat Shock Transcription Factor, Y-Linked)
483140 100 µL

HSFY2 (Heat Shock Transcription Factor, Y-Linked)

Sign In for Pricing
View Details
Mouse Monoclonal anti-Human CD218a (IL-18Ra) Antibody
xAP-0177 100 µg

Mouse Monoclonal anti-Human CD218a (IL-18Ra) Antibody

Sign In for Pricing
View Details