Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF7 Peptide - N-terminal region

RNF7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SAG, ROC2, rbx2, CKBBP1

UniProt

Q9UBF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF7 Rabbit Polyclonal Antibody (orb327338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLRX3 Antibody / Glutaredoxin 3 / PICOT
FY12722 100 µg

GLRX3 Antibody / Glutaredoxin 3 / PICOT

Sign In for Pricing
View Details
2-Hydroxyhippuric acid
FH24019-01 5 g

2-Hydroxyhippuric acid

Sign In for Pricing
View Details
2-Hydroxyhippuric acid
FH24019-02 10 g

2-Hydroxyhippuric acid

Sign In for Pricing
View Details
2-Hydroxyhippuric acid
FH24019-03 25 g

2-Hydroxyhippuric acid

Sign In for Pricing
View Details
2-Hydroxyhippuric acid
FH24019-04 50 g

2-Hydroxyhippuric acid

Sign In for Pricing
View Details
2-Hydroxyhippuric acid
FH24019-05 100 g

2-Hydroxyhippuric acid

Sign In for Pricing
View Details