SNCAIP Peptide - middle region
SNCAIP Peptide - middle region
Product Specifications
Product Name Alternative
Sph1, SYPH1
UniProt
Q9Y6H5
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNCAIP Rabbit Polyclonal Antibody (orb327339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FAB1941CL1 0.1 mL
Mouse Monoclonal LRIG2 Antibody (990310) [CoraFluor 1]
Sign In for Pricing
View Details 
MBS7100755 Inquire
Recombinant Human Cation channel sperm-associated protein subunit beta (CATSPERB) , partial
Sign In for Pricing
View Details 
MBS6271001-01 0.2 mL
ACOT9, ID (ACOT9, Acyl-coenzyme A thioesterase 9, mitochondrial, Acyl-CoA thioester hydrolase 9) (PE)
Sign In for Pricing
View Details MBS6271001-02 5x 0.2 mL
ACOT9, ID (ACOT9, Acyl-coenzyme A thioesterase 9, mitochondrial, Acyl-CoA thioester hydrolase 9) (PE)
Sign In for Pricing
View Details