Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM4A Peptide - C-terminal region

KDM4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677

UniProt

O75164

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDM4A Rabbit Polyclonal Antibody (orb331490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005271412

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Pyrrolidinopyridine
TRC-P997570-25G 25 g

4-Pyrrolidinopyridine

Sign In for Pricing
View Details
KRT13 (NM_153490) Human Recombinant Protein
TP760934 50 µg

KRT13 (NM_153490) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Cdkn1b activation kit by CRISPRa
GA200677 1 Kit

Mouse Cdkn1b activation kit by CRISPRa

Sign In for Pricing
View Details
CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI2D10]
CF811796 100 µg

CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI2D10]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgM,  20nm
GM-08-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgM, 20nm

Sign In for Pricing
View Details
AMPK alpha 2 Antibody (PRKAA2)
F50381-0.08ML 0.08 mL

AMPK alpha 2 Antibody (PRKAA2)

Sign In for Pricing
View Details