Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM19 Peptide - N-terminal region

RBM19 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBM19, KIAA0682

UniProt

Q9Y4C8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM19 Rabbit Polyclonal Antibody (orb327343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057280

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ULK3 activation kit by CRISPRa
GA108679 1 Kit

Human ULK3 activation kit by CRISPRa

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF594 conjugate, 0.1mg/mL
BNC942225-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta III Tubulin Mouse Monoclonal Antibody [A8-D10]
M0805-8 100 µL

Beta III Tubulin Mouse Monoclonal Antibody [A8-D10]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633501 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
KDM3A / JHDM2A (KDM3A) (NM_001146688) Human Over-expression Lysate
LC432099 20 µg

KDM3A / JHDM2A (KDM3A) (NM_001146688) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF405S conjugate, 0.1mg/mL
BNC042074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details