SUPT7L Peptide - C-terminal region
SUPT7L Peptide - C-terminal region
Product Specifications
Product Name Alternative
SPT7L, STAF65, SUPT7H, STAF65G, STAF65 (gamma)
UniProt
O94864
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SUPT7L Rabbit Polyclonal Antibody (orb327344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SGHGVLGSDVFEEPMSGMSEAGIPQSPDDSDSSYGSHSTDSLMGSSPVFN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
