Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPDL Peptide - middle region

HNRNPDL Peptide - middle region

Product Specifications

Product Name Alternative

HNRNP, JKTBP, HNRPDL, JKTBP2, LGMD1G, laAUF1

UniProt

O14979

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPDL Rabbit Polyclonal Antibody (orb327345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spetex-2E Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
45279066 1.0 µg DNA

Spetex-2E Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
EXOSC5 (Exosome Component 5, p12B, RRP46, RRP41B, Rrp46p, hRrp46p) (Biotin)
MBS6416510-01 0.1 mL

EXOSC5 (Exosome Component 5, p12B, RRP46, RRP41B, Rrp46p, hRrp46p) (Biotin)

Sign In for Pricing
View Details
EXOSC5 (Exosome Component 5, p12B, RRP46, RRP41B, Rrp46p, hRrp46p) (Biotin)
MBS6416510-02 5x 0.1 mL

EXOSC5 (Exosome Component 5, p12B, RRP46, RRP41B, Rrp46p, hRrp46p) (Biotin)

Sign In for Pricing
View Details
DUSP6 (Dual Specificity Protein Phosphatase 6, Dual Specificity Protein Phosphatase PYST1, Mitogen-activated Protein Kinase Phosphatase 3, MAP Kinase Phosphatase 3, MKP3, MKP-3, PYST1) (MaxLight 650)
D9840-12D-ML650 100 µL

DUSP6 (Dual Specificity Protein Phosphatase 6, Dual Specificity Protein Phosphatase PYST1, Mitogen-activated Protein Kinase Phosphatase 3, MAP Kinase Phosphatase 3, MKP3, MKP-3, PYST1) (MaxLight 650)

Sign In for Pricing
View Details
ZCCHC8 (NM_017612) Human Over-expression Lysate
LC413673 20 µg

ZCCHC8 (NM_017612) Human Over-expression Lysate

Sign In for Pricing
View Details
MagSi-STA 3.0 L
MD33001 2 mL

MagSi-STA 3.0 L

Sign In for Pricing
View Details