Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPDL Peptide - middle region

HNRNPDL Peptide - middle region

Product Specifications

Product Name Alternative

HNRNP, JKTBP, HNRPDL, JKTBP2, LGMD1G, laAUF1

UniProt

O14979

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPDL Rabbit Polyclonal Antibody (orb327345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Piezo2 Mouse Gene Knockout Kit (CRISPR)
KN513261 1 Kit

Piezo2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Ffar1 ELISA Kit
EF018711 96 Tests

Rat Ffar1 ELISA Kit

Sign In for Pricing
View Details
Rbm8a (NM_001102407) Mouse Recombinant Protein
PM48611M5 20 µg

Rbm8a (NM_001102407) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human Protein Wnt-7a ELISA Kit
MBS7273579-01 48 Well

Human Protein Wnt-7a ELISA Kit

Sign In for Pricing
View Details
Human Protein Wnt-7a ELISA Kit
MBS7273579-02 96 Well

Human Protein Wnt-7a ELISA Kit

Sign In for Pricing
View Details
Human Protein Wnt-7a ELISA Kit
MBS7273579-03 5x 96 Well

Human Protein Wnt-7a ELISA Kit

Sign In for Pricing
View Details