Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD6IP Peptide - C-terminal region

PDCD6IP Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIP1, ALIX, HP95, DRIP4

UniProt

Q8WUM4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDCD6IP Rabbit Polyclonal Antibody (orb588463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_037506

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGTL3 Double Nickase Plasmid (m)
sc-431491-NIC 20 µg

GGTL3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Amnionless Lentiviral Activation Particles (h)
sc-407657-LAC 200 µL

Amnionless Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
OR2L5 Double Nickase Plasmid (h)
sc-418896-NIC 20 µg

OR2L5 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Lentiviral mouse Krt2 shRNA (UAS) - Lentiviral mouse Krt2 shRNA (UAS, iRFP) plasmid
GTR15209020 1 Vial

Lentiviral mouse Krt2 shRNA (UAS) - Lentiviral mouse Krt2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Abat (NM_172961) Mouse Recombinant Protein
PM45998M5 20 µg

Abat (NM_172961) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human UNC5C knockdown cell line
ABC-KD16554 1 Vial

Human UNC5C knockdown cell line

Sign In for Pricing
View Details