Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD6IP Peptide - C-terminal region

PDCD6IP Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIP1, ALIX, HP95, DRIP4

UniProt

Q8WUM4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDCD6IP Rabbit Polyclonal Antibody (orb588463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_037506

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Four-Jointed Box Protein 1 (FJX1) ELISA Kit
MBS9940779 Inquire

Goat Four-Jointed Box Protein 1 (FJX1) ELISA Kit

Sign In for Pricing
View Details
HDAC2 (Phospho-Ser394) Rabbit pAb
E2310046 100 µL

HDAC2 (Phospho-Ser394) Rabbit pAb

Sign In for Pricing
View Details
Human RSK4 MAb (Clone 374521)
MAB3916-SP 25 µg

Human RSK4 MAb (Clone 374521)

Sign In for Pricing
View Details
Mouse Ptprn Pre-designed siRNA Set A
SI111446A 1 Each

Mouse Ptprn Pre-designed siRNA Set A

Sign In for Pricing
View Details
4-tert-Octylphenol Diethoxylate Benzyl Ether
161571 10 mg

4-tert-Octylphenol Diethoxylate Benzyl Ether

Sign In for Pricing
View Details
AdmiRa-hsa-miR-376c-5p Virus
mh2787 250 µL

AdmiRa-hsa-miR-376c-5p Virus

Sign In for Pricing
View Details