Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAMLD1 Peptide - C-terminal region

MAMLD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CG1, F18, HYSP2, CXorf6

UniProt

Q13495

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAMLD1 Rabbit Polyclonal Antibody (orb327347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSVASDSMPALPRQGCCHLFAWTSAASSVKPQHQHGNSFTSRQDPQPGDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit
MBS7278571-01 48 Well

Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit

Sign In for Pricing
View Details
Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit
MBS7278571-02 96 Well

Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit

Sign In for Pricing
View Details
Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit
MBS7278571-03 5x 96 Well

Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit

Sign In for Pricing
View Details
Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit
MBS7278571-04 10x 96 Well

Chicken Anti-Transglutaminase Antibodies IgG ELISA Kit

Sign In for Pricing
View Details
Human Protease, Serine 2 (PRSS2) ELISA Kit
QY-E01440 96 Tests

Human Protease, Serine 2 (PRSS2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Pichia pastoris MDM10 Protein (aa 1-445)
VAng-Cr6622-500gEcoli 500 µg (E. coli)

Recombinant Pichia pastoris MDM10 Protein (aa 1-445)

Sign In for Pricing
View Details