Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGK2 Peptide - N-terminal region

SGK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SGK2

UniProt

Q9HBY8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGK2 Rabbit Polyclonal Antibody (orb588466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-3- (trifluoromethyl) thiophene
LKB51002-01 50 mg

2-Bromo-3- (trifluoromethyl) thiophene

Sign In for Pricing
View Details
2-Bromo-3- (trifluoromethyl) thiophene
LKB51002-02 0.5 g

2-Bromo-3- (trifluoromethyl) thiophene

Sign In for Pricing
View Details
Human IgG (>95%)
E61I008-01 10 mg

Human IgG (>95%)

Sign In for Pricing
View Details
Human IgG (>95%)
E61I008-02 1 mg

Human IgG (>95%)

Sign In for Pricing
View Details
Human LIPG Protein Lysate
MBS8414535-01 0.02 mg

Human LIPG Protein Lysate

Sign In for Pricing
View Details
Human LIPG Protein Lysate
MBS8414535-02 5x 0.02 mg

Human LIPG Protein Lysate

Sign In for Pricing
View Details