Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POP7 Peptide - N-terminal region

POP7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

POP7, RPP20

UniProt

O75817

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POP7 Rabbit Polyclonal Antibody (orb588467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005828

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Cinnamylglycine
TRC-C442120-1G 1 g

N-Cinnamylglycine

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS640367 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: Myc.A7]
AM20707PU-N 100 µg

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: Myc.A7]

Sign In for Pricing
View Details
Chemerin (RARRES2) Human Gene Knockout Kit (CRISPR)
KN400383 1 Kit

Chemerin (RARRES2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMFR (Center) Rabbit Polyclonal Antibody
AP50160PU-N 400 µL

AMFR (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Metazachlor Ethane Sulfonic Acid-d6 Sodium Salt
TRC-M226234-2.5MG 2.5 mg

Metazachlor Ethane Sulfonic Acid-d6 Sodium Salt

Sign In for Pricing
View Details