Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POP7 Peptide - N-terminal region

POP7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

POP7, RPP20

UniProt

O75817

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POP7 Rabbit Polyclonal Antibody (orb588467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005828

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNTTIP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D1]
TA501131AM 100 µL

DNTTIP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D1]

Sign In for Pricing
View Details
C9orf135 Human Gene Knockout Kit (CRISPR)
KN421981 1 Kit

C9orf135 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histiocytoma Marker (D11), CF405S conjugate, 0.1mg/mL
BNC040348-100 1x 100 µL

Histiocytoma Marker (D11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dmtf1l Mouse Gene Knockout Kit (CRISPR)
KN500426 1 Kit

Dmtf1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS521340 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
FOXI1 Polyclonal Antibody
E-AB-19881-01 20 µL

FOXI1 Polyclonal Antibody

Sign In for Pricing
View Details