Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2BP2 Peptide - C-terminal region

CD2BP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LIN1, Snu40, FWP010, U5-52K, PPP1R59

UniProt

O95400

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD2BP2 Rabbit Polyclonal Antibody (orb327350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006101

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SOCS-3 Antibody [Janelia Fluor 669]
NBP2-27210JF669 0.1 mL

Rabbit Polyclonal SOCS-3 Antibody [Janelia Fluor 669]

Sign In for Pricing
View Details
Multidrug Resistance protein 3 (ABCB4) Mouse ELISA Kit
F1364 96 Tests

Multidrug Resistance protein 3 (ABCB4) Mouse ELISA Kit

Sign In for Pricing
View Details
RPGRIP1L Human siRNA Oligo Duplex (Locus ID 23322)
SR308185 1 Kit

RPGRIP1L Human siRNA Oligo Duplex (Locus ID 23322)

Sign In for Pricing
View Details
Mouse Granzyme B ELISA Kit
orb1086270 96 Tests

Mouse Granzyme B ELISA Kit

Sign In for Pricing
View Details
CLEC-2L (D-5) PE
sc-390424 PE 200 µg/mL

CLEC-2L (D-5) PE

Sign In for Pricing
View Details
ASS1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
12570154 3x 1.0 µg DNA

ASS1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details