NOP56 Peptide - C-terminal region
NOP56 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NOP56, NOL5A
UniProt
O00567
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NOP56 Rabbit Polyclonal Antibody (orb327351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006383
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941969-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041571-100 1x 100 µL
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details