Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNPH1 Peptide - N-terminal region

DNPH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNPH1 {ECO:0000255|HAMAP-Rule:MF_03036

UniProt

O43598

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNPH1 Rabbit Polyclonal Antibody (orb327353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLL1 siRNA (Rat)
MBS8212841-01 15 nmol

DLL1 siRNA (Rat)

Sign In for Pricing
View Details
DLL1 siRNA (Rat)
MBS8212841-02 30 nmol

DLL1 siRNA (Rat)

Sign In for Pricing
View Details
DLL1 siRNA (Rat)
MBS8212841-03 5x 30 nmol

DLL1 siRNA (Rat)

Sign In for Pricing
View Details
Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody
TA379387 100 µL

Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBE2N Rabbit mAb
C05818-100uL*2 2x 100μL

UBE2N Rabbit mAb

Sign In for Pricing
View Details
Rabbit Monoclonal L1CAM Antibody (L1CAM/9146R) [DyLight 650]
NBP3-24102C 0.1 mL

Rabbit Monoclonal L1CAM Antibody (L1CAM/9146R) [DyLight 650]

Sign In for Pricing
View Details