Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNPH1 Peptide - N-terminal region

DNPH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNPH1 {ECO:0000255|HAMAP-Rule:MF_03036

UniProt

O43598

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNPH1 Rabbit Polyclonal Antibody (orb327353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1371906 1.0 µg DNA

MYC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Silodosin-Beta-D-Glucuronide-d4
CS-O-30464 1 Each

Silodosin-Beta-D-Glucuronide-d4

Sign In for Pricing
View Details
Rabbit Anti-Human SOD2 pAb
PA7021-01 50 μL

Rabbit Anti-Human SOD2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SOD2 pAb
PA7021-02 100 μL

Rabbit Anti-Human SOD2 pAb

Sign In for Pricing
View Details
TRA2A Adenovirus (Mouse)
47423054 1.0 mL

TRA2A Adenovirus (Mouse)

Sign In for Pricing
View Details
TNFRSF10D Antibody
MBS9606265-01 0.1 mL

TNFRSF10D Antibody

Sign In for Pricing
View Details