Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG5 Peptide - middle region

SPAG5 Peptide - middle region

Product Specifications

Product Name Alternative

SPAG5

UniProt

Q96R06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG5 Rabbit Polyclonal Antibody (orb588472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006452

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDNLLSSLVILEVLSRQLRDWKSQLAVPHPETQDSSTQTDTSHSGITNKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEGAIN Mouse Monoclonal Antibody [Clone ID: OTI4E8]
TA810715S 30 µL

BEGAIN Mouse Monoclonal Antibody [Clone ID: OTI4E8]

Sign In for Pricing
View Details
Pax-3 (6288D4a)
sc-81351 100 µg/mL

Pax-3 (6288D4a)

Sign In for Pricing
View Details
CD31 monoclonal antibody
MB66025 50ul

CD31 monoclonal antibody

Sign In for Pricing
View Details
MYL9 Antibody
A73275-100UL 100 µL

MYL9 Antibody

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Sulfate adenylyltransferase subunit 2 (cysD)
MBS1192463-01 0.02 mg (E-Coli)

Recombinant Salmonella enteritidis PT4 Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Sulfate adenylyltransferase subunit 2 (cysD)
MBS1192463-02 0.02 mg (Yeast)

Recombinant Salmonella enteritidis PT4 Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details