Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG5 Peptide - middle region

SPAG5 Peptide - middle region

Product Specifications

Product Name Alternative

SPAG5

UniProt

Q96R06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG5 Rabbit Polyclonal Antibody (orb588472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006452

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDNLLSSLVILEVLSRQLRDWKSQLAVPHPETQDSSTQTDTSHSGITNKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Llama Monoclonal PD-1 Antibody (F25F4) - VHH - Azide and BSA Free
NBP3-12830 0.1 mg

Llama Monoclonal PD-1 Antibody (F25F4) - VHH - Azide and BSA Free

Sign In for Pricing
View Details
Relaxin (RLN) Rat ELISA Kit
G7163 96 Tests

Relaxin (RLN) Rat ELISA Kit

Sign In for Pricing
View Details
Bmpr2 Mouse siRNA Oligo Duplex (Locus ID 12168)
SR421824 1 Kit

Bmpr2 Mouse siRNA Oligo Duplex (Locus ID 12168)

Sign In for Pricing
View Details
Rabbit Monoclonal SNAP25 Antibody (JE45-86)
NBP3-32961 100 µL

Rabbit Monoclonal SNAP25 Antibody (JE45-86)

Sign In for Pricing
View Details
CD44, His, Cynomolgus
Z04122-100 100 µg

CD44, His, Cynomolgus

Sign In for Pricing
View Details
ATG16L1 Polyclonal Antibody
MBS129020-01 0.02 mL

ATG16L1 Polyclonal Antibody

Sign In for Pricing
View Details