Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG5 Peptide - N-terminal region

SPAG5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SPAG5

UniProt

Q96R06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG5 Rabbit Polyclonal Antibody (orb588473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006452

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSTCLTPNLVEMESQEAPGPAVEDVGRILGSDTESWMSPLAWLEKGVNTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SRRM3 activation kit by CRISPRa
GA116658 1 Kit

Human SRRM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene A HMPA
HA140015.25G 25 g

Polystyrene A HMPA

Sign In for Pricing
View Details
Akna Mouse Gene Knockout Kit (CRISPR)
KN501079 1 Kit

Akna Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C4BPA Mouse Monoclonal Antibody [Clone ID: 10-07]
AM01329PU-N 100 µg

C4BPA Mouse Monoclonal Antibody [Clone ID: 10-07]

Sign In for Pricing
View Details
Interleukin 34 (IL34) Human Gene Knockout Kit (CRISPR)
KN206629 1 Kit

Interleukin 34 (IL34) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BMPR2 Human Gene Knockout Kit (CRISPR)
KN208673RB 1 Kit

BMPR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details