Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEF4 Peptide - middle region

RAPGEF4 Peptide - middle region

Product Specifications

Product Name Alternative

EPAC, CGEF2, EPAC2, EPAC 2, Nbla00496, CAMP-GEFII

UniProt

Q8WZA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAPGEF4 Rabbit Polyclonal Antibody (orb327356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ror2 (Tyrosine-Protein Kinase transmembrane Receptor ROR2, mROR2, Neurotrophic Tyrosine Kinase, Receptor-Related 2, Ror2) (AP) discontinued
302712-AP 200 µL

Ror2 (Tyrosine-Protein Kinase transmembrane Receptor ROR2, mROR2, Neurotrophic Tyrosine Kinase, Receptor-Related 2, Ror2) (AP) discontinued

Sign In for Pricing
View Details
3- (Pyridine-2-carbonyl) pyridine
GCA97091 2.5 g

3- (Pyridine-2-carbonyl) pyridine

Sign In for Pricing
View Details
Human CD3 epsilon/CD3e CHO Stable Overexpression Lysate
MBS8114274-01 0.3 mg

Human CD3 epsilon/CD3e CHO Stable Overexpression Lysate

Sign In for Pricing
View Details
Human CD3 epsilon/CD3e CHO Stable Overexpression Lysate
MBS8114274-02 5x 0.3 mg

Human CD3 epsilon/CD3e CHO Stable Overexpression Lysate

Sign In for Pricing
View Details
Rat Zfp358 Pre-designed siRNA Set B
SI216325B 1 Each

Rat Zfp358 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Mouse Enoyl-CoA hydratase domain-containing protein 2, mitochondrial (Echdc2)
MBS1387257-01 0.02 mg (E-Coli)

Recombinant Mouse Enoyl-CoA hydratase domain-containing protein 2, mitochondrial (Echdc2)

Sign In for Pricing
View Details