Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEF4 Peptide - middle region

RAPGEF4 Peptide - middle region

Product Specifications

Product Name Alternative

EPAC, CGEF2, EPAC2, EPAC 2, Nbla00496, CAMP-GEFII

UniProt

Q8WZA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAPGEF4 Rabbit Polyclonal Antibody (orb327356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Transmembrane protein C9orf123 (C9orf123)
orb2933621-01 20 µg

Recombinant Human Transmembrane protein C9orf123 (C9orf123)

Sign In for Pricing
View Details
Recombinant Human Transmembrane protein C9orf123 (C9orf123)
orb2933621-02 100 µg

Recombinant Human Transmembrane protein C9orf123 (C9orf123)

Sign In for Pricing
View Details
KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Azide free) (HRP)
MBS6484562-01 0.2 mL

KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Azide free) (HRP)

Sign In for Pricing
View Details
KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Azide free) (HRP)
MBS6484562-02 5x 0.2 mL

KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Azide free) (HRP)

Sign In for Pricing
View Details
COG4, CT (Component Of Oligomeric Golgi Complex 4, Conserved Oligomeric Golgi Complex Subunit 4, COG Complex Subunit 4) (PE) discontinued
C7500-64-PE 200 µL

COG4, CT (Component Of Oligomeric Golgi Complex 4, Conserved Oligomeric Golgi Complex Subunit 4, COG Complex Subunit 4) (PE) discontinued

Sign In for Pricing
View Details
KCNJ4 Rabbit Polyclonal Antibody
orb575393 100 µL

KCNJ4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details