Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREX2 Peptide - C-terminal region

TREX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TREX2

UniProt

Q9BQ50

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREX2 Rabbit Polyclonal Antibody (orb331491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_542432

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rusc1 Mouse Gene Knockout Kit (CRISPR)
KN515212 1 Kit

Rusc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LINC02875 (NM_203425) Human Over-expression Lysate
LC404288 20 µg

LINC02875 (NM_203425) Human Over-expression Lysate

Sign In for Pricing
View Details
DAZL (NM_001351) Human Over-expression Lysate
LY400541 100 µg

DAZL (NM_001351) Human Over-expression Lysate

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), 0.2mg/mL
BNUB0488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), 0.2mg/mL

Sign In for Pricing
View Details
QuicKey Pro Human OPG (Osteoprotegerin) ELISA Kit
E-OSEL-H0034-01 24 Tests

QuicKey Pro Human OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human OPG (Osteoprotegerin) ELISA Kit
E-OSEL-H0034-02 48 Tests

QuicKey Pro Human OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details