Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREX2 Peptide - C-terminal region

TREX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TREX2

UniProt

Q9BQ50

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREX2 Rabbit Polyclonal Antibody (orb331491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_542432

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIFBP Antibody
KC-2218-01 50 μL

KIFBP Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2218-02 100 µL

KIFBP Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2218-03 1 mL

KIFBP Antibody

Sign In for Pricing
View Details
CMTM7 Human qPCR Primer Pair (NM_138410)
HP216965 200 Reactions

CMTM7 Human qPCR Primer Pair (NM_138410)

Sign In for Pricing
View Details
PCR Cabinet BPCR-103
BPCR-103 1 Unit

PCR Cabinet BPCR-103

Sign In for Pricing
View Details
Mitochondrial Marker (MTC754), CF568 conjugate, 0.1mg/mL
BNC680754-100 1x 100 µL

Mitochondrial Marker (MTC754), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details