Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHP1 Peptide - middle region

CHP1 Peptide - middle region

Product Specifications

Product Name Alternative

CHP1, CHP

UniProt

Q99653

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHP1 Rabbit Polyclonal Antibody (orb327357) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_009167

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL37P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV733772 1.0 µg DNA

MRPL37P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Sec16A Polyclonal Antibody
E20-74228 100 µg

Sec16A Polyclonal Antibody

Sign In for Pricing
View Details
Gdf5-set siRNA/shRNA/RNAi Lentivector (Mouse)
21419094 4x 500 ng

Gdf5-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
ST8SIA2 Rabbit pAb
A7748-01 20 µL

ST8SIA2 Rabbit pAb

Sign In for Pricing
View Details
ST8SIA2 Rabbit pAb
A7748-02 100 μL

ST8SIA2 Rabbit pAb

Sign In for Pricing
View Details
ST8SIA2 Rabbit pAb
A7748-03 500 μL

ST8SIA2 Rabbit pAb

Sign In for Pricing
View Details