Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHP1 Peptide - middle region

CHP1 Peptide - middle region

Product Specifications

Product Name Alternative

CHP1, CHP

UniProt

Q99653

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHP1 Rabbit Polyclonal Antibody (orb327357) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_009167

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Phenylene Dibenzoate
OR1029771-01 1 g

1,3-Phenylene Dibenzoate

Sign In for Pricing
View Details
1,3-Phenylene Dibenzoate
OR1029771-02 5 g

1,3-Phenylene Dibenzoate

Sign In for Pricing
View Details
1,3-Phenylene Dibenzoate
OR1029771-03 25 g

1,3-Phenylene Dibenzoate

Sign In for Pricing
View Details
1,3-Phenylene Dibenzoate
OR1029771-04 100 g

1,3-Phenylene Dibenzoate

Sign In for Pricing
View Details
1,3-Phenylene Dibenzoate
OR1029771-05 500 g

1,3-Phenylene Dibenzoate

Sign In for Pricing
View Details
1-[ (5-Chloro-2-thienyl) sulfonyl]piperidine-2-carboxylic acid
IQB03862-01 50 mg

1-[ (5-Chloro-2-thienyl) sulfonyl]piperidine-2-carboxylic acid

Sign In for Pricing
View Details